Total number of results for Arthropod CHH/MIH/GIH/VIH hormone are 117
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP00613 |
RFTFDCPGMMGQRYLYEQVEQVCDDCYNLYREEKIAVNCRENCFLNSWFTVCLQATMREHETPRFDIWR
|
69 | Jasus lalandii | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | 11072117#Marco HG, Stoeva S, Voelter W, Gäde G#Characterization and sequence elucidation of a novel peptide with molt-inhibiting activity from the South African spiny lobster, Jasus lalandii#Peptides 2000 Sep;21(9):1313-21 | |
NP00614 |
EXYXKQSAFNAVS
|
13 | Locusta migratoria | Arthropod CHH/MIH/GIH/VIH hormone | locustamyoinhibin | 7972937#Schoofs L, Veelaert D, Holman GM, Hayes TK, De Loof A#Partial identification, synthesis and immunolocalization of locustamyoinhibin, the third myoinhibiting neuropeptide isolated from Locusta migratoria#Regul Pept 1994 Jul 14;52(2):139-56 | |
NP00615 |
RSAEGLGRMG
|
10 | Callinectes sapidus | Arthropod CHH/MIH/GIH/VIH hormone | CPRP[1-10] | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP00616 |
RSAEGLGRMGRL
|
12 | Callinectes sapidus | Arthropod CHH/MIH/GIH/VIH hormone | CPRP[1-12] | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP00617 |
RSAEGLGRMGRLL
|
13 | Callinectes sapidus | Arthropod CHH/MIH/GIH/VIH hormone | CPRP[1-13] | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP00618 |
LASLKSDTVTPLR
|
13 | Callinectes sapidus | Arthropod CHH/MIH/GIH/VIH hormone | CPRP[13-25] | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP00619 |
ASLKSDTVTPLR
|
12 | Callinectes sapidus | Arthropod CHH/MIH/GIH/VIH hormone | CPRP[14-25] | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP00620 |
SLKSDTVTPLR
|
11 | Callinectes sapidus | Arthropod CHH/MIH/GIH/VIH hormone | CPRP[15-25] | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP00621 |
SDTVTPLRGFE
|
11 | Callinectes sapidus | Arthropod CHH/MIH/GIH/VIH hormone | CPRP[18-28] | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP00622 |
RSAEGLGRM
|
9 | Callinectes sapidus | Arthropod CHH/MIH/GIH/VIH hormone | CPRP[1-9] | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP00623 |
TPLRGFEGETGHPLE
|
15 | Callinectes sapidus | Arthropod CHH/MIH/GIH/VIH hormone | CPRP[22-36] | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP00624 |
RVINDDCPNLIGNR
|
14 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MIH[1-14] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00625 |
RVINDDCPNLIGNRD
|
15 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MIH[1-15] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00626 |
KVEWICEDCSNIFR
|
14 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MIH[19-32] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00627 |
VEWICEDCSNIFR
|
13 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MIH[20-32] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00628 |
VINDDCPNLIGNR
|
13 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MIH[2-14] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00629 |
VINDDCPNLIGNRDLYK
|
17 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MIH[2-18] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00630 |
NTGMATLCR
|
9 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MIH[33-41] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00631 |
KNCFFNEDFLWCVYATER
|
18 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MIH[42-59] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00632 |
NCFFNEDFLWCVYATER
|
17 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MIH[43-59] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00633 |
RRINNDCQNFIGNRAMYE
|
18 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MOIH[1-18] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00634 |
VDWICKDCANIFR
|
13 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MOIH[20-32] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00635 |
RINNDCQNFIGNR
|
13 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MOIH[2-14] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00636 |
DCANIFR
|
7 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MOIH[26-32] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00637 |
DCANIFRQDGLLNNCR
|
16 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MOIH[26-41] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00638 |
CANIFRKDGLLNNCRSNCFYNTE
|
23 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MOIH[27-49] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00639 |
INNDCQNFIGNR
|
12 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MOIH[3-14] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00640 |
QDGLLNNCR
|
9 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MOIH[33-41] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00641 |
SNCFYNTEFLWCIDATENTR
|
20 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MOIH[42-61] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00642 |
EQLEQWAAILGAGWN
|
15 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MOIH[64-78] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00643 |
QWAAILGAGWN
|
11 | Cancer borealis | Arthropod CHH/MIH/GIH/VIH hormone | MOIH[68-78] | 23028060#Jia C, Hui L, Cao W, Lietz CB, Jiang X, Chen R, Catherman AD, Thomas PM, Ge Y, Kelleher NL, Li L#High-definition de novo sequencing of crustacean hyperglycemic hormone (CHH)-family neuropeptides#Mol Cell Proteomics 2012 Dec;11(12):1951-64 | |
NP00644 |
PSAALAVEHGTTHPLE
|
16 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00645 |
RSTPGYGRMDRIL
|
13 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00646 |
RSTPGYGRMDRILAA
|
15 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00647 |
RSTPGYGRMDRILAALKTSPMEPSAALAVEHGTTHPLE
|
38 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00648 |
RSTQGYGRMDPIL
|
13 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00649 |
RSTQGYGRMDRILAA
|
15 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00650 |
RSTQGYGRMDRILAALKTSPMEPSAALAVEHGTTHPLE
|
38 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00651 |
SPMEPSAALAVEHGTTHPLE
|
20 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00652 |
TSPMEPSAALAVEHGTTHPLE
|
21 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00653 |
PLGFLSQDHS
|
10 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00654 |
PLGFLSQDHSV
|
11 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00655 |
PLGFLSQDHSVN
|
12 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00656 |
RSVEGASRMEKL
|
12 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00657 |
RSVEGASRMEKLL
|
13 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00658 |
RSVEGASRMEKLLS
|
14 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00659 |
RSVEGASRMEKLLSS
|
15 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00660 |
RSVEGASRMEKLLSSS
|
16 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00661 |
RSVEGASRMEKLLSSSN
|
17 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00662 |
RSVEGASRMEKLLT
|
14 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00663 |
RSVEGVSRME
|
10 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00664 |
RSVEGVSRMEKLL
|
13 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00665 |
RSVEGVSRMEKLLS
|
14 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00666 |
RSVEGVSRMEKLLSSISPSSTPLGFLSQDHSVN
|
33 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00667 |
RSVEGVSRMEKLLT
|
14 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00668 |
GPAESSGESAHPLE
|
14 | Ocypode ceratophthalma | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00669 |
LLTSLRGPAESSGESAHPLE
|
20 | Ocypode ceratophthalma | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00670 |
LPSAHPLE
|
8 | Ocypode ceratophthalma | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00671 |
LTSLRGPAESSGESAHPLE
|
19 | Ocypode ceratophthalma | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00672 |
RGPAESSGESAHPLE
|
15 | Ocypode ceratophthalma | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00673 |
SLRGPAESDGESAHPLE
|
17 | Ocypode ceratophthalma | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00674 |
SLRGPAESSGESAHPLE
|
17 | Ocypode ceratophthalma | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00675 |
SLRGPAESSGESALSE
|
16 | Ocypode ceratophthalma | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00676 |
TSLRGPAESSGESAHPLE
|
18 | Ocypode ceratophthalma | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00677 |
RSVESSGSSSSEPLSFLSQDQSVN
|
24 | Orconectes limosus | Arthropod CHH/MIH/GIH/VIH hormone | CPRPv1 | 14981133#Bulau P, Meisen I, Schmitz T, Keller R, Peter-Katalinić J#Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry#Mol Cell Proteomics 2004 Jun;3(6):558-64 | |
NP00678 |
RSVESSGSSSSEPLSFLSQDQSVS
|
24 | Orconectes limosus | Arthropod CHH/MIH/GIH/VIH hormone | CPRPv2 | 14981133#Bulau P, Meisen I, Schmitz T, Keller R, Peter-Katalinić J#Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry#Mol Cell Proteomics 2004 Jun;3(6):558-64 | |
NP00679 |
HEEYQAHVQTV
|
11 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycaemic hormones | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
NP00680 |
AHVQTVGK
|
8 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
NP00681 |
SFFTLECKGVFDAAIFARLDRICDDCFNLFREPQLYTLCRAECFTTPYFKGCMESLYLYDEKEQIDQMIDFV
|
72 | Bombyx mori | Arthropod CHH/MIH/GIH/VIH hormone | CHH-like protein | ||
NP00682 |
RVINDDCPNLIGNRDLYKKVEWICDDCANIYRSTGMASLCRKDCFFNEDFLWCVRATERSEDLAQLKQWVTILGAGRI
|
78 | Callinectes sapidus | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | ||
NP00683 |
RSAQGMGKMERLLASYRGALEPSTPLGDLSGSLGHPVE
|
38 | Cancer pagurus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 9809792#Chung J.S., Wilkinson M.C., Webster S.G.; #Amino acid sequences of both isoforms of crustacean hyperglycemic hormone (CHH) and corresponding precursor-related peptide in Cancer pagurus.; #Regul. Pept. 77:17-24(1998). | |
NP00684 |
RSTQGYGRMDRILAALKTSPMEPSAALAVENGTTHPLE
|
38 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 1788131#Tensen C.P., Verhoeven A.H.M., Gaus G., Janssen K.P.C., Keller R., van Herp F.; #Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.; #Peptides 12:673-681(1991). | |
NP00685 |
QIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRSNCYSNLVFRQCMDDLLMMDEFDQYARKVQMV
|
72 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone | 2792364# Kegel G., Reichwein B., Weese S., Gaus G., Peter-Katalinic J., Keller R.; #Amino acid sequence of the crustacean hyperglycemic hormone (CHH) from the shore crab, Carcinus maenas.; # FEBS Lett. 255:10-14(1989).$8841399#Chung J.S., Webster S.G.; #Does the N-terminal pyroglutamate residue have any physiological significance for crab hyperglycemic neuropeptides?; #Eur. J. Biochem. 240:358-364(1996). | |
NP00686 |
RVINDECPNLIGNRDLYKKVEWICEDCSNIFRKTGMASLCRRNCFFNEDFVWCVHATERSEELRDLEEWVGILGAGRD
|
78 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | 1679945#Webster S.G.; #Amino acid sequence of putative moult-inhibiting hormone from the crab Carcinus maenas.; #Proc. R. Soc. B 244:247-252(1991). | |
NP00687 |
RVFNDDCPNLMGNRDLYKKVEWICDDCANIFRIPGMASICRKDCFFNEDFLWCVRATERTEEMMQLKQWVRILGAGRM
|
78 | Charybdis feriatus | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | ||
NP00688 |
RSVEGASRMEKLLSSSNSPSSTPLGFLSQDHSVN
|
34 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide A(Potential) | ||
NP00689 |
QVFDQACKGVYDRNLFKKLDRVCEDCYNLYRKPFVATTCRENCYSNWVFRQCLDDLLLSDVIDEYVSNVQMV
|
72 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone A | 2169734#Chang E.S., Prestwich G.D., Bruce M.J.; #Amino acid sequence of a peptide with both molt-inhibiting and hyperglycemic activities in the lobster, Homarus americanus.; #Biochem. Biophys. Res. Commun. 171:818-826(1990). | |
NP00690 |
RSVEGVSRMEKLLSSSISPSSTPLGFLSQDHSVN
|
34 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide B | 1788131#Tensen C.P., Verhoeven A.H.M., Gaus G., Janssen K.P.C., Keller R., van Herp F.; #Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.; #Peptides 12:673-681(1991). | |
NP00691 |
QVFDQACKGVYDRNLFKKLNRVCEDCYNLYRKPFIVTTCRENCYSNRVFRQCLDDLLLSDVIDEYVSNVQMV
|
72 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone B | ||
NP00692 |
ASAWFTNDECPGVMGNRDLYEKVAWVCNDCANIFRNNDVGVMCKKDCFHTMDFLWCVYATERHGEIDQFRKWVSILRA
|
78 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | Gonad-inhibiting hormone | 1791922#Soyez D., Le Caer J.-P., Noel P.Y., Rossier J.; #Primary structure of two isoforms of the vitellogenesis inhibiting hormone from the lobster Homarus americanus.; #Neuropeptides 20:25-32(1991). | |
NP00693 |
RSTQGYGRMDKLLATLMGSSEGGALESASQHSLE
|
34 | Libinia emarginata | Arthropod CHH/MIH/GIH/VIH hormone | MOIH precursor-related peptide | ||
NP00694 |
QIFDPSCKGLYDRGLFSDLEHVCKDCYNLYRNPQVTSACRVNCYSNRVFRQCMEDLLLMEDFDKYARAIQTV
|
72 | Libinia emarginata | Arthropod CHH/MIH/GIH/VIH hormone | Mandibular organ-inhibiting hormone | 9299429#Liu L., Laufer H., Wang Y., Hayes T.; #A neurohormone regulating both methyl farnesoate synthesis and glucose metabolism in a crustacean.; #Biochem. Biophys. Res. Commun. 237:694-701(1997). | |
NP00695 |
SLFDPSCTGVFDRQLLRRLRRVCDDCFNVFREPNVSTECRSNCYNNEVFRQCMEYLLPPHLHEEHRLAVQMV
|
72 | Litopenaeus vannamei | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone | 8812330#Sefiani M., Le Caer J.-P., Soyez D.; #Characterization of hyperglycemic and molt-inhibiting activity from sinus glands of the penaeid shrimp Penaeus vannamei.; #Gen. Comp. Endocrinol. 103:41-53(1996). | |
NP00696 |
DTFDHSCKGIYDRELFRKLDRVCEDCYNVFREPKVATECKSNCFVNKRFNVCVADLRHDVSRFLKMANSALS
|
72 | Litopenaeus vannamei | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone-like | ||
NP00697 |
WSLDGLARIEKLLSTSSSASAASPTRGQALNL
|
32 | Macrobrachium lanchesteri | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | ||
NP00698 |
AILDQSCKGIFDRELFKKLDRVCDDCYNLYRKPYVAIDCREGCYQNLVFRQCIQDLQLMDQLDEYANAVQIV
|
72 | Macrobrachium lanchesteri | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone | ||
NP00699 |
RVINDDCPNLIGNRDLYKRVEWICEDCSNIFRNTGMATLCRKNCFFNEDFLWCVYATERTEEMSQLRQWVGILGAGRE
|
78 | Metacarcinus magister | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | ||
NP00700 |
ASSPRVDHRLV
|
11 | Metapenaeus ensis | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide B | ||
NP00701 |
SLFDPSCTGVFDRELLGRLNRVCDDCYNVFREPKVATECRSHCFLNPAFIQCLEYIIPEVLHEEYQANVQLV
|
72 | Metapenaeus ensis | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone B | ||
NP00702 |
SYIENTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRDRCFNNEWFLVCLKAANRDDELDKFKVWISILNPGL
|
77 | Metapenaeus ensis | Arthropod CHH/MIH/GIH/VIH hormone | Probable molt-inhibiting hormone | ||
NP00703 |
RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVS
|
33 | Orconectes limosus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide A | 1788131#Tensen C.P., Verhoeven A.H.M., Gaus G., Janssen K.P.C., Keller R., van Herp F.; #Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.; #Peptides 12:673-681(1991). | |
NP00704 |
QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVLDEYISGVQTV
|
72 | Orconectes limosus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone | 1800954#Kegel G., Reichwein B., Tensen C.P., Keller R.; #Amino acid sequence of crustacean hyperglycemic hormone (CHH) from the crayfish, Orconectes limosus: emergence of a novel neuropeptide family.; #Peptides 12:909-913(1991). | |
NP00705 |
RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVN
|
33 | Orconectes limosus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide A | 1788131#Tensen C.P., Verhoeven A.H.M., Gaus G., Janssen K.P.C., Keller R., van Herp F.; #Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.; #Peptides 12:673-681(1991). | |
NP00706 |
SPVDAFSPPEASLTGGQSLS
|
20 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 1 | ||
NP00707 |
SLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVATECRSNCYNNPVFRQCMAYVVPAHLHNEHREAVQMV
|
72 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 1 | 9210164#Yang W.-J., Aida K., Nagasawa H.; #Amino acid sequences and activities of multiple hyperglycemic hormones from the kuruma prawn, Penaeus japonicus.; #Peptides 18:479-485(1997). | |
NP00708 |
DAFSPPEASLTGGQSLS
|
17 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 2 | ||
NP00709 |
SLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVAMECRSNCYNNPVFRQCMEYLLPAHLHDEYRLAVQMV
|
72 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 2 | 9210164#Yang W.-J., Aida K., Nagasawa H.; #Amino acid sequences and activities of multiple hyperglycemic hormones from the kuruma prawn, Penaeus japonicus.; #Peptides 18:479-485(1997). | |
NP00710 |
RSFDASPSATSGNHSLN
|
17 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 3 | ||
NP00711 |
SLFDPACTGIYDRQLLRKLGRLCDDCYNVFREPKVATGCRSNCYHNLIFLDCLEYLIPSHLQEEHMAAMQTV
|
72 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 3 | ||
NP00712 |
RSSEDLSAPEDRSLS
|
15 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 5 | ||
NP00713 |
LVFDPSCAGVYDRVLLGKLNRLCDDCYNVFREPNVATECRSNCFYNLAFVQCLEYLMPPSLHEEYQANVQMV
|
72 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 5 | 9210164#Yang W.-J., Aida K., Nagasawa H.; #Amino acid sequences and activities of multiple hyperglycemic hormones from the kuruma prawn, Penaeus japonicus.; #Peptides 18:479-485(1997). | |
NP00714 |
RSLEGSSSPVTSLTRGRSLN
|
20 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 7 | ||
NP00715 |
AAFDPSCTGVYDRELLGRLSRLCDDCYNVFREPKVAMECRSNCFFNPAFVQCLEYLIPAELHEEYQALVQTV
|
72 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 7 | ||
NP00716 |
SFIDNTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRNRCFYNEWFLICLKAANREDEIEKFRVWISILNAGQ
|
77 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | 8801521#Yang W.-J., Aida K., Terauchi A., Sonobe H., Nagasawa H.; #Amino acid sequence of a peptide with molt-inhibiting activity from the kuruma prawn Penaeus japonicus.; #Peptides 17:197-202(1996). | |
NP00717 |
DALSPPAAGLGADHSFT
|
17 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 1 | ||
NP00718 |
SLFDPSCTGVFDRQLLRRLSRVCDDCFNVFREPNVATECRSNCYNNEVFRQCMEYLLPAHLHEEHRLAVQMV
|
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 1 | ||
NP00719 |
RSLEGSSSPVASLIRGRSLS
|
20 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 2 | ||
NP00720 |
ANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRSNCFYNPVFVQCLEYLIPADLHEEYQAHVQTV
|
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 2 | ||
NP00721 |
RSFN
|
4 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 3 | ||
NP00722 |
ANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRNNCFYNPVFVQCLEYLIPADLHEEYQAHVQTV
|
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 3 | ||
NP00723 |
RSLDASPSSAFSGNHSLS
|
18 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 4 | ||
NP00724 |
SLFDPACTGIYDRQLLGKLGRLCDDCYNVFREPKVATGCRSNCYYNLIFLDCLEYLIPSHLQEEHMEALQTV
|
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 4 | ||
NP00725 |
ANFDPSCAGVYDRELLGGLSRLCDDCYNVFREPKVATECRSNCFYNSVFVQCLEYLIPADLHEEYQAHVQTV
|
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 5 | ||
NP00726 |
QVFDQACKGIYDRAIFKKLELVCDDCYNLYRKPKVATTCRENCYANSVFRQCLDDLLLINVVDEYISGVQIV
|
72 | Procambarus bouvieri | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | 8735961#Aguilar M.B., Falchetto R., Shabanowitz J., Hunt D.F., Huberman A.; #Complete primary structure of the molt-inhibiting hormone (MIH) of the Mexican crayfish Procambarus bouvieri (Ortmann).; #Peptides 17:367-374(1996). | |
NP00727 |
RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVN
|
33 | Procambarus clarkii | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide(Potential) | ||
NP00728 |
QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVVDEYISGVQTV
|
72 | Procambarus clarkii | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone | 7821776#Yasuda A., Yasuda Y., Fujita T., Naya Y.; #Characterization of crustacean hyperglycemic hormone from the crayfish (Procambarus clarkii): multiplicity of molecular forms by stereoinversion and diverse functions.; #Gen. Comp. Endocrinol. 95:387-398(1994). | |
NP00729 |
SFFDIQCKGVYDKSIFARLDRICEDCYNLFREPQLHSLCRSDCFKSPYFKGCLQALLLIDEEEKFNQMVEIL
|
72 | Schistocerca gregaria | Arthropod CHH/MIH/GIH/VIH hormone | Ion transport peptide |